Recombinant Mesocricetus auratus 3 beta-hydroxysteroid dehydrogenase/Delta 5-->4-isomerase type 2 (HSD3B2)

Shipped with Ice Packs
In Stock

Description

General Information

HSD3B2, or 3 beta-hydroxysteroid dehydrogenase/Delta 5-->4-isomerase type 2, is an enzyme that, in humans, is encoded by the HSD3B2 gene . It is expressed in the adrenal cortex and gonads, where it facilitates the conversion of Δ5-3β-hydroxysteroids into Δ4-3-keto isomers . This enzyme plays a vital role in steroidogenesis by converting pregnenolone to progesterone, 17α-hydroxypregnenolone (17OHPreg) to 17α-hydroxyprogesterone (17OHP), and dehydroepiandrosterone (DHEA) to androstenedione .

Function and Significance

The HSD3B2 enzyme is essential for the production of steroid hormones, which are crucial for various physiological processes. These processes include:

  • Sexual development and function

  • Stress response

  • Electrolyte balance

Deficiency and Mutations

Mutations in the HSD3B2 gene can result in congenital adrenal hyperplasia (CAH), leading to salt-wasting (SW) and ambiguous genitalia . Biallelic loss-of-function variants in HSD3B2 present with salt wasting, genital ambiguity, and hypogonadism in both sexes . The severity of the condition can vary based on the specific mutation and its impact on enzyme activity .

Mutations Identified

Several mutations in the HSD3B2 gene have been identified in individuals with classical 3βHSD deficiency . These mutations include:

  • Splicing mutations

  • In-frame deletions

  • Nonsense mutations

  • Frameshift mutations

  • Missense mutations

Functional Characterization of Mutations

Functional characterization studies have been conducted to assess the impact of mutations on enzyme activity . These studies often involve expressing mutant recombinant proteins in cells and measuring their ability to convert substrates into products .

A study evaluated enzymatic activities of HSD3B2 mutants, with or without SW, and found that AR-mediated transactivation was markedly decreased in mutant gene-transfected cells compared to wild type protein transfected cells. C72R, S124G, and M225V mutants completely eliminated enzymatic activities, while V299I showed some residual activity (19.9% versus wild type) .

Association with Kidney Function

HSD3B2 expression shows a strong correlation with kidney function, as supported by data from Nephroseq and the Human Protein Atlas .

Research Methods for Evaluation

Methods to evaluate the enzymatic activity of 3β-HSDs to multiple substrates have been developed, offering a useful approach for comprehensive analyses of HSD3B2 mutant proteins that cause heterogenous clinical features . One such method involves comparing the potential for PR- and AR-mediated transactivation between substrates (P5 and DHEA) and products (P4 and A4) at various concentrations in CV-1 cells .

Table of Mutations and Their Effects

MutationEffects
C72RComplete disappearance of enzymatic activities
S124GComplete disappearance of enzymatic activities
M225VComplete disappearance of enzymatic activities
V299IShowed some residual activity (19.9% versus wild type) in AR-mediated transactivation ; 67.3% in PR

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your preferred format in order notes for customized preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Please consult your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50% and serves as a guideline.
Shelf Life
Shelf life depends on several factors: storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt; aliquot for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is determined during production. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
HSD3B2; 3 beta-hydroxysteroid dehydrogenase/Delta 5-->4-isomerase type 2; 3 beta-hydroxysteroid dehydrogenase/Delta 5-->4-isomerase type II; 3-beta-HSD II [Includes: 3-beta-hydroxy-Delta(5-steroid dehydrogenase; 3-beta-hydroxy-5-ene steroid dehydrogenase; Progesterone reductase; Steroid Delta-isomerase; Delta-5-3-ketosteroid isomerase]
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
2-373
Protein Length
Full Length of Mature Protein
Species
Mesocricetus auratus (Golden hamster)
Target Names
HSD3B2
Target Protein Sequence
PGWSCLVTGAGGFLGQRIIHLLVQEKDLEEVRLLDKVFRPETREEFFKLQTKTKVTVLEG DILDAQCLRRACQGISVVIHTAAAIDVWGIIPRQTIIDINVKGTLNLLEACVQASVPAFI YTSSIDVAGPNSYKEIVLNGHEEQQHESTWSDPYPYSKMMAEKAVLAANGSFLKNGGTLH TCALRPMYIYGEKSSILSGIMIRAIKNNGILKVTGKFSTVNPVYVSNAAWAHILAARGLQ DPKKSPNIQGQFYYISDDTPHQSYDDLNNTLSKKWGLRPDSSWRPPVALLYWLGFLLELV NFLLRPVYNYQPPFTRYLVTISNTVFTFSYKKAQRDLGYEPLVGWEEARENTSEWIGSLV EQHKGTLNTKAQ
Uniprot No.

Target Background

Function

3β-HSD is a bifunctional enzyme catalyzing the oxidative conversion of Δ5-ene-3β-hydroxy steroids and the oxidative conversion of ketosteroids. The 3β-HSD enzymatic system plays a critical role in the biosynthesis of all hormonal steroid classes.

Protein Families
3-beta-HSD family
Subcellular Location
Endoplasmic reticulum membrane; Single-pass membrane protein. Mitochondrion membrane; Single-pass membrane protein.
Tissue Specificity
High levels in adrenal gland, kidney and male liver. Low levels in female liver.

Q&A

What is HSD3B2 and what role does it play in steroidogenesis?

3 beta-hydroxysteroid dehydrogenase/Delta 5-->4-isomerase type 2 (HSD3B2) is a critical enzyme in the steroidogenesis pathway that catalyzes the conversion of delta-5 steroids to delta-4 steroids. Specifically, it transforms pregnenolone to progesterone and dehydroepiandrosterone (DHEA) to androstenedione, which are essential precursors for the production of mineralocorticoids, glucocorticoids, and sex steroids. In humans, HSD3B2 is primarily expressed in the gonads and adrenal glands, playing a crucial role in sexual development and adrenal function . The enzyme contains both dehydrogenase and isomerase activities that work in concert to facilitate these conversions.

The hamster (Mesocricetus auratus) HSD3B enzyme shares similar functional characteristics with human HSD3B2, making it a valuable research model for investigating steroidogenic processes and disorders related to this enzyme's dysfunction.

How does Mesocricetus auratus HSD3B2 compare structurally and functionally to human HSD3B isoforms?

Mesocricetus auratus (golden hamster) HSD3B2 shares significant structural homology with human HSD3B isoforms, particularly in the catalytic domains. While specific data on hamster HSD3B2 is somewhat limited, comparative studies show that the enzyme maintains the core functional domains necessary for steroid conversion activities observed in human HSD3B2.

Human HSD3B enzymes exist in two primary isoforms: HSD3B1 and HSD3B2. HSD3B1 is expressed predominantly in placenta and peripheral tissues, while HSD3B2 is expressed in adrenal glands and gonads . Studies suggest that human HSD3B1 typically demonstrates higher enzymatic activity than HSD3B2, although the difference is not always statistically significant .

The functional comparison between species shows that hamster HSD3B enzymes maintain similar substrate specificities to human enzymes, allowing for valid comparative research. Research has demonstrated that enzymatic activities of various mammalian HSD3B1 proteins, including ovine and guinea pig variants, can be detected using the same assay systems developed for human enzymes .

What is the significance of using Mesocricetus auratus as a model organism for HSD3B2 research?

The Syrian golden hamster (Mesocricetus auratus) has emerged as a valuable model organism for various biological studies due to its unique anatomical and physiological features . For HSD3B2 research specifically, this model offers several advantages:

  • Genetic similarity: Hamster HSD3B enzymes share considerable homology with human counterparts, allowing for meaningful extrapolation of research findings.

  • Established experimental protocols: Methodologies for working with hamster models are well-documented, facilitating reproducible research.

  • Size and handling: Hamsters are relatively small and easily handled in laboratory settings while still being large enough for adequate tissue sampling.

  • Established genetic and genomic resources: The mitochondrial genome of Mesocricetus auratus has been fully sequenced and analyzed, providing valuable comparative genomic information .

Studies have successfully re-established the Syrian golden hamster as an amenable animal model for investigating complex disease processes, demonstrating its versatility as a research subject .

What methodologies are most effective for evaluating enzymatic activity of recombinant Mesocricetus auratus HSD3B2?

The evaluation of recombinant Mesocricetus auratus HSD3B2 enzymatic activity can be achieved through various methodologies, with reporter assay systems showing particular promise based on research with human HSD3B2.

A highly sensitive approach involves using cell-based reporter assays to detect the conversion of substrates (P5 and DHEA) to products (progesterone and androstenedione). This methodology has been effectively applied to human HSD3B2 research and can be adapted for hamster enzymes:

Methodology overview:

  • Transduction of HEK293 cells to express the target HSD3B2

  • Incubation with medium containing substrates (P5 or DHEA)

  • Measurement of product formation via luciferase reporter systems in CV-1 cells transfected with:

    • PR/AR expression vectors

    • Progesterone-/androgen-responsive reporters

This system is advantageous due to its high sensitivity and ability to rapidly detect substrate conversion through strong responses to progesterone and androstenedione from ectopic expression of PR and AR in CV-1 cells, which have low background activity of C3 group nuclear receptors .

How do mutations in HSD3B2 affect enzymatic function, and how can these be studied using recombinant systems?

Mutations in HSD3B2 can significantly impact enzymatic function, leading to varying degrees of enzyme deficiency and associated clinical phenotypes. Recombinant expression systems offer powerful tools to evaluate these effects.

Recent research has demonstrated that various missense mutations in the HSD3B2 gene produce distinct effects on enzymatic activity, with differential impacts depending on the substrate. For example, in human HSD3B2 studies:

Table 1: Impact of HSD3B2 Mutations on Enzymatic Activities

MutationConversion of P5 to P4Conversion of DHEA to A4Clinical Presentation
Wild type100%100%Normal
C72RMarkedly reducedMarkedly reducedAmbiguous genitalia with salt-wasting
S124GMarkedly reducedMarkedly reducedAmbiguous genitalia with salt-wasting
V225DMarkedly reducedMarkedly reducedAmbiguous genitalia with salt-wasting
V299IReduced (>50% of wild type)Markedly reducedAmbiguous genitalia without salt-wasting

This research reveals an important finding: some mutations (like V299I) can affect the conversion of different substrates to varying degrees, potentially explaining the heterogeneity in clinical presentations . The V299 position is part of putative membrane-spanning domains possibly involved in substrate specificity, suggesting that mutations in these domains may show fluctuation in enzymatic activity dependent on the substrates.

To study Mesocricetus auratus HSD3B2 mutations, similar recombinant expression systems can be employed, providing valuable insights into structure-function relationships and comparative enzyme biology.

What are the implications of HSD3B2 deficiency for reproductive development and fertility in research models?

HSD3B2 deficiency has profound implications for reproductive development and fertility, as evidenced by studies in humans that can inform research with Mesocricetus auratus models.

In humans, 3β-hydroxysteroid dehydrogenase deficiency results in a rare disorder of sexual development and steroidogenesis . Clinical case studies have revealed several key implications:

Interestingly, not all HSD3B2 mutations result in complete infertility. A case study of a male patient with a homozygous c.687del27 mutation showed normal adult spermatic characteristics according to WHO 2010 criteria, with a sperm concentration of 57.6 million/mL (normal >15) and 21% typical forms (normal >4) .

These findings provide valuable reference points for reproductive and developmental studies in Mesocricetus auratus models with induced or naturally occurring HSD3B2 variations.

What are the optimal conditions for storage and handling of recombinant Mesocricetus auratus HSD3B2 protein?

The stability and activity of recombinant Mesocricetus auratus HSD3B2 protein are significantly influenced by storage and handling conditions. Based on established protocols for similar recombinant proteins:

Storage recommendations:

  • For lyophilized forms, maintain at -20°C/-80°C for up to 12 months

  • For liquid forms, store at -20°C/-80°C for up to 6 months

  • Avoid repeated freezing and thawing, which can compromise protein integrity

  • Store working aliquots at 4°C for no more than one week

Reconstitution protocol:

  • Briefly centrifuge the vial prior to opening to bring contents to the bottom

  • Reconstitute in deionized sterile water to a concentration of 0.1-1.0 mg/mL

  • Add glycerol to a final concentration of 5-50% (50% is recommended as default)

  • Aliquot for long-term storage at -20°C/-80°C

The shelf life is influenced by multiple factors including storage state, buffer ingredients, storage temperature, and the intrinsic stability of the protein itself. These recommendations are based on established protocols for recombinant Mesocricetus auratus proteins and can be applied to HSD3B2 with appropriate validation.

How can recombinant Mesocricetus auratus HSD3B2 be effectively expressed in heterologous systems?

Effective expression of recombinant Mesocricetus auratus HSD3B2 in heterologous systems requires careful consideration of expression vectors, host cells, and purification strategies.

Expression system selection:
Mammalian cell expression systems have demonstrated success in producing functional HSD3B proteins. HEK293 cells have been effectively used for expressing human HSD3B2 and can likely be adapted for Mesocricetus auratus HSD3B2 . These cells provide appropriate post-translational modifications essential for enzyme function.

Expression protocol framework:

  • Clone the complete coding sequence of Mesocricetus auratus HSD3B2 into an appropriate mammalian expression vector

  • Verify sequence integrity through DNA sequencing

  • Transfect or transduce HEK293 cells with the expression construct

  • Select stable transformants if long-term expression is desired

  • Verify protein expression through Western blotting or immunofluorescence

  • Assess enzymatic activity using appropriate substrate conversion assays

Purification considerations:
For obtaining purified recombinant protein, affinity tags (typically determined during the manufacturing process) can facilitate purification while minimizing impact on protein function . Purification protocols should be optimized to maintain protein stability and enzymatic activity.

Quality control:
Verify protein purity using SDS-PAGE (aim for >85% purity) and confirm enzymatic activity through functional assays before proceeding with experimental applications.

What approaches can be used to study substrate specificity of Mesocricetus auratus HSD3B2 compared to human isoforms?

Investigating the substrate specificity of Mesocricetus auratus HSD3B2 in comparison to human isoforms requires sophisticated experimental approaches that can detect differences in enzyme kinetics and substrate preferences.

Comparative enzymatic assay system:
A cell-based reporter system has proven effective for evaluating human HSD3B enzymatic activities toward different substrates and can be adapted for comparative studies:

  • Express recombinant Mesocricetus auratus HSD3B2 and human HSD3B2 in parallel systems (e.g., HEK293 cells)

  • Incubate with various concentrations of potential substrates (e.g., pregnenolone, DHEA)

  • Measure product formation using receptor-mediated transactivation assays

  • Calculate and compare enzyme kinetics parameters (Km, Vmax) for each substrate

This approach can be expanded to include structure-function studies using chimeric enzymes or site-directed mutagenesis to identify regions responsible for species-specific differences in substrate preference.

Experimental considerations:

  • Ensure equivalent expression levels of different isoforms for valid comparisons

  • Include appropriate negative and positive controls

  • Account for differential receptor activation potentials of various products

  • Consider the impact of membrane localization and cellular context on enzyme activity

Research with human HSD3B isoforms has shown that HSD3B1 typically demonstrates higher enzymatic activity than HSD3B2 , and such comparative studies can reveal important insights about the evolutionary conservation and functional specialization of these enzymes across species.

How can Mesocricetus auratus HSD3B2 models contribute to understanding human congenital adrenal hyperplasia?

Mesocricetus auratus HSD3B2 models present valuable opportunities for investigating human congenital adrenal hyperplasia (CAH) caused by 3β-hydroxysteroid dehydrogenase deficiency, a rare form resulting from HSD3B2 gene mutations .

Translational value of hamster models:

  • Similar steroidogenic pathways allow for relevant disease modeling

  • Comparable enzyme structure facilitates the study of homologous mutations

  • Whole-organism physiology enables examination of systemic effects

  • Reproductive similarities permit investigation of fertility consequences

Research applications:

  • Evaluating the impact of specific mutations on steroid production profiles

  • Investigating developmental consequences of enzyme deficiency

  • Testing potential therapeutic interventions

  • Studying long-term physiological adaptations to altered steroidogenesis

The value of such models is underscored by clinical observations in human patients with HSD3B2 deficiency, who present with heterogeneous phenotypes ranging from severe salt-wasting with ambiguous genitalia to milder forms with varying degrees of virilization .

What methodological approaches are recommended for generating and validating Mesocricetus auratus HSD3B2 knockdown or mutant models?

Creating valid Mesocricetus auratus HSD3B2 models requires careful methodological approaches to ensure accurate representation of human disease mechanisms.

Recommended methodologies:

  • CRISPR/Cas9 gene editing:

    • Design guide RNAs targeting conserved regions of hamster HSD3B2

    • Screen for specific mutations that mirror human pathogenic variants

    • Validate editing efficiency through sequencing

    • Establish stable breeding lines carrying defined mutations

  • Antisense oligonucleotide (ASO) knockdown:

    • Design ASOs targeting hamster HSD3B2 mRNA

    • Optimize delivery methods for relevant tissues (adrenal, gonadal)

    • Validate knockdown efficiency via RT-qPCR and Western blotting

    • Assess phenotypic consequences through biochemical and physiological measures

  • Validation approaches:

    • Steroid profiling using LC-MS/MS to confirm altered steroidogenic pathways

    • Histological examination of adrenal and gonadal tissues

    • Gene expression analysis of steroidogenic and compensatory pathways

    • Functional tests of adrenal and gonadal hormone production

Table 2: Key Validation Parameters for HSD3B2 Models

ParameterMethodologyExpected Findings in Deficiency
Pregnenolone/Progesterone ratioLC-MS/MSElevated
DHEA/Androstenedione ratioLC-MS/MSElevated
Adrenal steroidogenic enzyme expressionRT-qPCR, IHCCompensatory upregulation
Gonadal developmentHistology, UltrasoundDevelopmental abnormalities
Mineralocorticoid functionElectrolyte balancePotential salt-wasting
Glucocorticoid functionACTH stimulationBlunted cortisol response

The validation process should consider that defects in HSD3B2 may be partially compensated by HSD3B1 activity in peripheral tissues, mirroring observations in human patients .

What are emerging areas of investigation for Mesocricetus auratus HSD3B2 in comparative endocrinology?

Emerging research areas for Mesocricetus auratus HSD3B2 in comparative endocrinology include several promising directions that leverage advances in molecular biology, genetics, and analytical technologies:

  • Comparative genomics and evolution:

    • Investigating the evolutionary conservation of HSD3B2 across species

    • Analyzing selective pressures on steroidogenic enzymes in different ecological niches

    • Exploring the genomic organization of steroidogenic enzyme gene clusters

  • Regulatory mechanisms:

    • Characterizing species-specific transcriptional regulation of HSD3B2

    • Investigating epigenetic modifications affecting enzyme expression

    • Exploring post-translational modifications unique to hamster HSD3B2

  • Enzyme structure-function relationships:

    • Developing high-resolution structural models of hamster HSD3B2

    • Comparative analysis of catalytic domains across species

    • Identifying species-specific substrate binding pocket variations

  • Biotechnological applications:

    • Utilizing hamster HSD3B2 in biocatalytic applications

    • Engineering enhanced variants for steroid biotransformation

    • Developing novel inhibitors with species-selective profiles

These research directions build upon established knowledge while exploring new frontiers in understanding the basic biology and applied potential of this important steroidogenic enzyme.

How might advances in protein engineering impact research with recombinant Mesocricetus auratus HSD3B2?

Advances in protein engineering offer exciting possibilities for enhancing research with recombinant Mesocricetus auratus HSD3B2, potentially transforming both basic and applied studies:

  • Enhanced stability and expression:

    • Computational design of stabilizing mutations

    • Codon optimization for improved expression in heterologous systems

    • Fusion tags that enhance solubility while preserving activity

  • Functional modifications:

    • Engineering altered substrate specificity through rational design

    • Creating hamster-human chimeric enzymes to investigate functional domains

    • Developing activity-based sensors for real-time monitoring of enzyme function

  • Structural insights:

    • Designing crystallization-friendly variants for structural studies

    • Site-specific incorporation of biophysical probes

    • Cryo-EM compatible constructs for structural analysis

  • Therapeutic relevance:

    • Development of engineered HSD3B2 variants as potential enzyme replacement therapies

    • Creation of high-throughput screening platforms for identifying modulators

    • Design of immunologically silent variants for in vivo applications

These advances could significantly enhance our understanding of structure-function relationships in HSD3B2 enzymes and potentially lead to novel therapeutic approaches for human HSD3B2 deficiency disorders.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.